136 846288

October 14th 2007







136 846288

NEC Option Gear 136-846288-001A
Alan Computech International is a wholesaler, distributor and reseller of Hewlett Packard, Compaq, IBM, Gateway, NEC and Packard Bell surplus computer products and components. (more...)

www.gsaadvantage.gov
Tags:   www gsaadvantage gov

NEC
NEC Option Gear 136-846288-001A Regular: $15.00 Sale: $7.50: NEC P300 Cover New MCPG-CV01 $15.00: NEC PC Cover Shutter 136-644738-001 $15.00: NEC Tilt Unit Unit 808-812981-001 (more...)
Tags:   NEC

www.oralgen.lanl.gov
... ref|ZP_00236820.1| UDP-N-acetylenolpyruvoylgluc... 206 1e-51 gi|30263911|ref|NP_846288.1| ... 1e-30 gi|83858913|ref|ZP_00952435.1| UDP-N-acetylenolpyruvoylgluc... 136 1e-30 gi ... (more...)
Tags:   www oralgen lanl gov

Gene-groups and Orthologues
76. yacL.119: ChrI_VC0605.594 +:+ 134340..134750: 636642..637022: 136: 126: 17:136: 1:123: missing:missing: 123: 31: 139: 1 77. hpt.125: ChrI_VC0585.574 +:+ 141419..141967: 613472..614005: 182: 177: 5:182: 1:177 "2.4.2.8 ... (more...)

www.data.scec.org
20775146.136 1839727.412 6 1417760.520 8. 24302041.190 -1633328.238 3 ... 24149454.690 -1169381.501 3 -846288.967 2. 22958242.706 13311946.307 5 10357147 ... (more...)
Tags:   www data scec org

www.oralgen.lanl.gov
... ref|YP_085250.1| UDP-N-acetylenolpyruvoylglucos... 164 6e-39 gi|30263911|ref|NP_846288.1| ... GLPGSVGGA +M Sbjct: 77 LSLRRFRSLHTQTQRDGSVLVHAGAGLPVAALLAFCAHHALRGLETFAGLPGSVGGAAYM 136 ... (more...)
Tags:   www oralgen lanl gov

BLAST Search Results
... e-137 ref|ZP_01354629.1| Radical SAM [Clostridium phytofermentans... 490 e-136 emb ... ref|YP_842989.1| Radical SAM domain protein [Methanosaeta t... 44 0.036 ref|YP_846288.1| ... (more...)
Tags:   BLAST Search Results

Approved Vendors List
136-203961-0020 non saleable part cut sheet guide assy for colote ps 136-214271-3010 plate assy 136-215359-401a middle cover assy 136-217747-401a top cover p6200 (more...)

Gene-groups and Orthologues
7. yacL.119: VC0605.594 +:+ 134340..134750: 636642..637022: 136: 126: 17..136: 1..123: missing:missing: 123: 31: 139: 1 8. hemL.154: VC0626.614-:-173602..174882: 664265..665563: 426: 432: 1..426: 1..426 "5.4.3.8 ... (more...)

Posted under Forex Tips | No Comments »

Next »

Close
E-mail It